Amyloid β-peptide (1-40) (rat) (DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV)
98%
science Other reagents with same CAS 144409-98-3
blur_circular Chemical Specifications
description Product Description
Amyloid β-peptide (1-40) (rat) is widely used in neuroscience and Alzheimer's disease research. It serves as a model to study the aggregation and toxicity of amyloid peptides, which are key factors in the pathogenesis of Alzheimer's. Researchers utilize this peptide to investigate the mechanisms of amyloid plaque formation, neuronal cell death, and synaptic dysfunction. It is also employed in drug discovery to screen and test potential therapeutic compounds aimed at inhibiting amyloid aggregation or reducing its neurotoxic effects. Additionally, it is used in biochemical assays to study interactions with other proteins, lipids, and cellular components, providing insights into the molecular basis of neurodegeneration.
shopping_cart Available Sizes & Pricing
Cart
No products