GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

BR

Reagent Code: #105932

blur_circular Chemical Specifications

scatter_plot Molecular Information
Weight 3850.31 g/mol
inventory_2 Storage & Handling
Storage -20°C

description Product Description

This peptide sequence is a synthetic analog resembling GLP-1 receptor agonists and is primarily used in research and development within biotechnology and pharmaceuticals. It is studied for its potential to mimic glucagon-like peptide-1 (GLP-1) effects, including glucose regulation, insulin secretion stimulation, and glucagon suppression. Key applications focus on developing therapeutics for type 2 diabetes and obesity. Researchers explore its interactions with GLP-1 receptors and biological molecules to understand functions in metabolic pathways, with emerging interests in neuroprotection, cardiovascular benefits, and immune modulation. Additionally, it serves in biosensors, protein folding and stability studies, molecular recognition, and as a model for personalized medicine and targeted therapies.

shopping_cart Available Sizes & Pricing

Size Availability Unit Price Quantity
inventory 5mg
10-20 days ฿70,560.00

Cart

No products

Subtotal: 0.00
Total 0.00 THB