FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

BR

Reagent Code: #105920

blur_circular Chemical Specifications

scatter_plot Molecular Information
Weight 3692.15 g/mol
inventory_2 Storage & Handling
Storage -20°C

description Product Description

This peptide sequence is primarily used in research and development within the fields of biochemistry and molecular biology. It is often employed in studies related to protein-protein interactions, as it can serve as a model or target sequence to investigate binding mechanisms. Additionally, it may be utilized in the development of antibodies or as a synthetic antigen to study immune responses. Its specific structure allows it to be a valuable tool in understanding conformational changes in proteins and their functional implications. Researchers also use it in peptide synthesis experiments to optimize production techniques and analyze purification processes.

shopping_cart Available Sizes & Pricing

Size Availability Unit Price Quantity
inventory 5mg
10-20 days ฿70,560.00

Cart

No products

Subtotal: 0.00
Total 0.00 THB
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
No image available
This peptide sequence is primarily used in research and development within the fields of biochemistry and molecular biology. It is often employed in studies related to protein-protein interactions, as it can serve as a model or target sequence to investigate binding mechanisms. Additionally, it may be utilized in the development of antibodies or as a synthetic antigen to study immune responses. Its specific structure allows it to be a valuable tool in understanding conformational changes in proteins and their functional implications. Researchers also use it in peptide synthesis experiments to optimize production techniques and analyze purification processes.
Mechanism -
Appearance -
Longevity -
Strength -
Storage -
Shelf Life -
Allergen(s) -
Dosage (Range) -
Dosage (Per Day) -
Mix Method -
Heat Resistance -
Stable in pH range -
Solubility -
Product Types -
INCI -

Purchase History for

Loading purchase history...