GLP-2(1-33)(human),GLP-2 (human),Glucagon-like peptide 2 (human),HADGSFSDEMNTILDNLAARDFINWLIQTKITD

BR

Reagent Code: #105926
fingerprint
CAS Number 223460-79-5

science Other reagents with same CAS 223460-79-5

blur_circular Chemical Specifications

scatter_plot Molecular Information
Weight 2816.28 g/mol
Formula C₁₂₆H₂₀₇N₃₇O₃₄S
inventory_2 Storage & Handling
Storage -20°C

description Product Description

GLP-2 (human) is primarily used in medical and therapeutic applications due to its role in promoting intestinal growth and function. It is particularly effective in treating conditions like short bowel syndrome (SBS), where it enhances nutrient absorption by increasing the surface area of the intestinal lining. This peptide also supports gut health by reducing inflammation and improving barrier function, making it valuable in managing inflammatory bowel diseases (IBD) such as Crohn’s disease. Additionally, GLP-2 has shown potential in treating conditions like osteoporosis, as it may improve bone density by enhancing calcium absorption in the intestines. Its ability to stimulate cell proliferation and repair in the gastrointestinal tract makes it a promising candidate for further research in regenerative medicine and gastrointestinal disorders.

shopping_cart Available Sizes & Pricing

Size Availability Unit Price Quantity
inventory 1mg
10-20 days ฿29,115.00

Cart

No products

Subtotal: 0.00
Total 0.00 THB
GLP-2(1-33)(human),GLP-2 (human),Glucagon-like peptide 2 (human),HADGSFSDEMNTILDNLAARDFINWLIQTKITD
No image available
GLP-2 (human) is primarily used in medical and therapeutic applications due to its role in promoting intestinal growth and function. It is particularly effective in treating conditions like short bowel syndrome (SBS), where it enhances nutrient absorption by increasing the surface area of the intestinal lining. This peptide also supports gut health by reducing inflammation and improving barrier function, making it valuable in managing inflammatory bowel diseases (IBD) such as Crohn’s disease. Additionally, GLP-2 has shown potential in treating conditions like osteoporosis, as it may improve bone density by enhancing calcium absorption in the intestines. Its ability to stimulate cell proliferation and repair in the gastrointestinal tract makes it a promising candidate for further research in regenerative medicine and gastrointestinal disorders.
Mechanism -
Appearance -
Longevity -
Strength -
Storage -
Shelf Life -
Allergen(s) -
Dosage (Range) -
Dosage (Per Day) -
Mix Method -
Heat Resistance -
Stable in pH range -
Solubility -
Product Types -
INCI -

Purchase History for

Loading purchase history...