GLP-1(7-37),HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

>98%

Reagent Code: #105925
fingerprint
CAS Number 106612-94-6

science Other reagents with same CAS 106612-94-6

blur_circular Chemical Specifications

scatter_plot Molecular Information
Weight 3355.67 g/mol
Formula C₁₅₁H₂₂₈N₄₀O₄₇
inventory_2 Storage & Handling
Storage -20°C

description Product Description

GLP-1(7-37) is widely used in the treatment of type 2 diabetes due to its ability to enhance insulin secretion in a glucose-dependent manner. This peptide helps regulate blood sugar levels by stimulating insulin release from pancreatic beta cells while inhibiting glucagon secretion, which reduces hepatic glucose production. Additionally, it slows gastric emptying, contributing to better postprandial glucose control. Beyond diabetes management, GLP-1(7-37) has shown potential in promoting weight loss by increasing satiety and reducing appetite, making it beneficial for obesity-related conditions. Its therapeutic applications are also being explored in cardiovascular health, as it may improve heart function and reduce the risk of cardiovascular events in diabetic patients.

format_list_bulleted Product Specification

Test Parameter Specification
Appearance White to Off-White Solid
Purity (%) 98-100
LCMS Conforms to Structure

shopping_cart Available Sizes & Pricing

Size Availability Unit Price Quantity
inventory 5mg
10-20 days ฿53,028.00

Cart

No products

Subtotal: 0.00
Total 0.00 THB
GLP-1(7-37),HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
No image available
GLP-1(7-37) is widely used in the treatment of type 2 diabetes due to its ability to enhance insulin secretion in a glucose-dependent manner. This peptide helps regulate blood sugar levels by stimulating insulin release from pancreatic beta cells while inhibiting glucagon secretion, which reduces hepatic glucose production. Additionally, it slows gastric emptying, contributing to better postprandial glucose control. Beyond diabetes management, GLP-1(7-37) has shown potential in promoting weight loss by increasing satiety and reducing appetite, making it beneficial for obesity-related conditions. Its therapeutic applications are also being explored in cardiovascular health, as it may improve heart function and reduce the risk of cardiovascular events in diabetic patients.
Mechanism -
Appearance -
Longevity -
Strength -
Storage -
Shelf Life -
Allergen(s) -
Dosage (Range) -
Dosage (Per Day) -
Mix Method -
Heat Resistance -
Stable in pH range -
Solubility -
Product Types -
INCI -

Purchase History for

Loading purchase history...