VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

BR

Reagent Code: #65755

blur_circular Chemical Specifications

scatter_plot Molecular Information
Weight 3241.7 g/mol
inventory_2 Storage & Handling
Storage -20°C

description Product Description

This peptide sequence is a synthetic or naturally derived peptide that is primarily used in research and development within the fields of biochemistry and molecular biology. Its applications include:

  1. Protein-Protein Interaction Studies: It is utilized to investigate how proteins interact with each other, which is crucial for understanding cellular processes and signaling pathways.
  2. Drug Development: The peptide may serve as a template or target for designing new therapeutic agents, particularly in the development of drugs that modulate protein interactions.
  3. Biomarker Research: It can be employed in the identification and validation of biomarkers for various diseases, aiding in early diagnosis and treatment strategies.
  4. Enzyme Activity Studies: Researchers use this peptide to study enzyme kinetics and mechanisms, helping to elucidate the role of specific enzymes in biological systems.
  5. Immunological Research: The peptide might be used in immunological studies to understand immune responses and develop vaccines or immunotherapies.

Overall, this peptide is a valuable tool in advancing scientific knowledge and developing new medical treatments.

shopping_cart Available Sizes & Pricing

Size Availability Unit Price Quantity
inventory 5mg
10-20 days ฿70,560.00

Cart

No products

Subtotal: 0.00
Total 0.00 THB