VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
BR
blur_circular Chemical Specifications
description Product Description
This peptide sequence is a synthetic or naturally derived peptide that is primarily used in research and development within the fields of biochemistry and molecular biology. Its applications include:
- Protein-Protein Interaction Studies: It is utilized to investigate how proteins interact with each other, which is crucial for understanding cellular processes and signaling pathways.
- Drug Development: The peptide may serve as a template or target for designing new therapeutic agents, particularly in the development of drugs that modulate protein interactions.
- Biomarker Research: It can be employed in the identification and validation of biomarkers for various diseases, aiding in early diagnosis and treatment strategies.
- Enzyme Activity Studies: Researchers use this peptide to study enzyme kinetics and mechanisms, helping to elucidate the role of specific enzymes in biological systems.
- Immunological Research: The peptide might be used in immunological studies to understand immune responses and develop vaccines or immunotherapies.
Overall, this peptide is a valuable tool in advancing scientific knowledge and developing new medical treatments.
shopping_cart Available Sizes & Pricing
Cart
No products